RetrogeneDB ID: | retro_ecab_606 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 23:31646049..31646255(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PET100 | ||
| Ensembl ID: | ENSECAG00000008451 | ||
| Aliases: | None | ||
| Description: | PET100 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:40038] |
| Percent Identity: | 65.71 % |
| Parental protein coverage: | 90.79 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | FRMTLYLTFPVAMFWIANQAEWFED-YVIQRKRELWPPEKEDQRQELEEFKERIRKQREEKLLRAARQSS |
| F...L.L.FPVAMFWIANQAEWFED..V...KRELWPP.K....QELE.FKER...Q.E.KLL.AAR..S | |
| Retrocopy | FQIML*LIFPVAMFWIANQAEWFED<LVTPHKRELWPPKKAA*SQELEDFKERRQRQQEQKLLQAAR*NS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 8 .85 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 13 .97 RPM |
| SRP021940_embryo | 0 .00 RPM | 14 .12 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 20 .25 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 12 .27 RPM |
| SRP021940_testis | 0 .00 RPM | 42 .84 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008524 | 2 retrocopies | |
| Equus caballus | ENSECAG00000008451 | 1 retrocopy |
retro_ecab_606 ,
|
| Felis catus | ENSFCAG00000023931 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027594 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000039245 | 1 retrocopy |