RetrogeneDB ID: | retro_amel_878 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192705.1:304277..304496(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PET100 | ||
| Ensembl ID: | ENSAMEG00000008524 | ||
| Aliases: | None | ||
| Description: | PET100 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:40038] |
| Percent Identity: | 53.42 % |
| Parental protein coverage: | 95.95 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | VKLEVFRMTLYLTFPVAMFWIANQAEWFEDYVIQRKRELWPPEKED--QELEEFKERIRKQREEKLLRAA |
| V..E.F...LYL...V.MFWIA.Q..WFEDY.IQ.K.EL...EKED..Q.L.EF.E.....R.EKLL..A | |
| Retrocopy | VQSEMFQIMLYLIVSVTMFWIAYQKQWFEDYIIQNKEEL*TLEKEDQHQDLKEFREDPETARAEKLLQVA |
| Parental | QQS |
| ..S | |
| Retrocopy | RRS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008524 | 2 retrocopies |
retro_amel_591, retro_amel_878 ,
|
| Equus caballus | ENSECAG00000008451 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023931 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000027594 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000039245 | 1 retrocopy |