RetrogeneDB ID: | retro_ecab_375 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 16:35447681..35447915(-) | ||
| Located in intron of: | ENSECAG00000014047 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DUT | ||
| Ensembl ID: | ENSECAG00000015971 | ||
| Aliases: | None | ||
| Description: | deoxyuridine triphosphatase [Source:HGNC Symbol;Acc:3078] |
| Percent Identity: | 58.23 % |
| Parental protein coverage: | 50.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | ARPAEGSGMRLRFTRLSEHATAPTKGSARAAGYDLYSAYDYTVPPMEKALVKTDIQIALPSGCYGRVAPR |
| A.P.E..G..L.F..L.EH.TAPT.GS.....YDL.S..D..V..MEK.L.KTDI..ALPSGCY.RV.P. | |
| Retrocopy | AWPVEKDGTWLHFICLLEHVTAPTRGSLKVTCYDL*ST*DSRVH-MEKTLMKTDIKMALPSGCYRRVVPH |
| Parental | SGLAAKHFI |
| SGL.AK.FI | |
| Retrocopy | SGLDAKLFI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .06 RPM | 7 .32 RPM |
| SRP021940_cerebellum | 0 .05 RPM | 11 .84 RPM |
| SRP021940_embryo | 0 .10 RPM | 27 .90 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 5 .34 RPM |
| SRP021940_synovial_membrane | 0 .16 RPM | 7 .33 RPM |
| SRP021940_testis | 0 .06 RPM | 15 .54 RPM |