RetrogeneDB ID: | retro_ecab_360 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 16:41618421..41618609(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SHFM1 | ||
| Ensembl ID: | ENSECAG00000018179 | ||
| Aliases: | None | ||
| Description: | split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845] |
| Percent Identity: | 71.83 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSN-QLRAELEKHGYKMET |
| MSEK.QPVDLGLL.E.....EFPAED.AGLDED..AHVWEDN.D.DN...D....QL.AELEKHGYKMET | |
| Retrocopy | MSEKTQPVDLGLLKE----DEFPAEDKAGLDED--AHVWEDN*D-DNNVQDDFS<QL*AELEKHGYKMET |
| Parental | S |
| S | |
| Retrocopy | S |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 25 .97 RPM |
| SRP021940_cerebellum | 0 .05 RPM | 15 .94 RPM |
| SRP021940_embryo | 0 .31 RPM | 33 .40 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 38 .54 RPM |
| SRP021940_synovial_membrane | 0 .08 RPM | 27 .34 RPM |
| SRP021940_testis | 0 .13 RPM | 29 .73 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010434 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018179 | 1 retrocopy |
retro_ecab_360 ,
|
| Erinaceus europaeus | ENSEEUG00000002237 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000015337 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011501 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016474 | 3 retrocopies |