RetrogeneDB ID: | retro_ecab_269 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 11:49607901..49608075(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C11orf58 | ||
| Ensembl ID: | ENSECAG00000011778 | ||
| Aliases: | None | ||
| Description: | chromosome 11 open reading frame 58 [Source:HGNC Symbol;Acc:16990] |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 65.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | RKQKFLRLMGAGKKEHTGRLVIGDHKSTSHFRTGEEDKKINEELESQYQQSMDSKLSGRY |
| .K.K...L.G.GKK.HTGRLV.GD..S.SHF..G.EDKK...E..SQYQ...DS...G.. | |
| Retrocopy | KKKKLWGLTGTGKKIHTGRLVKGDVESPSHF--GTEDKKMSREGKSQYQARADSTFAGSF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .12 RPM | 20 .66 RPM |
| SRP021940_cerebellum | 0 .26 RPM | 15 .58 RPM |
| SRP021940_embryo | 0 .08 RPM | 35 .96 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 25 .84 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 16 .28 RPM |
| SRP021940_testis | 0 .06 RPM | 17 .58 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030220 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009626 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009679 | 2 retrocopies | |
| Equus caballus | ENSECAG00000011778 | 1 retrocopy |
retro_ecab_269 ,
|
| Felis catus | ENSFCAG00000027747 | 1 retrocopy | |
| Homo sapiens | ENSG00000110696 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000011795 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001589 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007147 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000030663 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000017719 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025335 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000000154 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003458 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020436 | 1 retrocopy |