RetrogeneDB ID: | retro_ecab_1001 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 8:79540228..79540437(-) | ||
| Located in intron of: | ENSECAG00000020437 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PSME1 | ||
| Ensembl ID: | ENSECAG00000016855 | ||
| Aliases: | None | ||
| Description: | proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) [Source:HGNC Symbol;Acc:9568] |
| Percent Identity: | 65.28 % |
| Parental protein coverage: | 59.17 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | PVNCNEKIVVLLQRLKPEIKDVIEQ-LNPVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTALHTKLEGFH |
| P.N...K.VV.LQRLKP....VIEQ....VT.WL.LQIP..EDGN.FG.AVQE.VFELMT.LHTKL.GF. | |
| Retrocopy | PMN-GKKMVVVLQRLKPGTRPVIEQ<VSLVTIWLPLQIPWLEDGNSFGMAVQETVFELMTTLHTKLIGFN |
| Parental | TQ |
| .Q | |
| Retrocopy | LQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 18 .42 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 21 .29 RPM |
| SRP021940_embryo | 0 .00 RPM | 27 .72 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 27 .09 RPM |
| SRP021940_synovial_membrane | 0 .05 RPM | 23 .83 RPM |
| SRP021940_testis | 0 .06 RPM | 19 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016433 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000021395 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000011924 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012620 | 2 retrocopies | |
| Equus caballus | ENSECAG00000016855 | 1 retrocopy |
retro_ecab_1001 ,
|
| Felis catus | ENSFCAG00000005583 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014712 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000022216 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019041 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000008620 | 1 retrocopy |