RetrogeneDB ID: | retro_dord_216 | ||
Retrocopylocation | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | GeneScaffold_5764:11998..12224(+) | ||
| Located in intron of: | ENSDORG00000005202 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Hspe1 | ||
| Ensembl ID: | ENSDORG00000011071 | ||
| Aliases: | None | ||
| Description: | heat shock protein 1 (chaperonin 10) [Source:MGI Symbol;Acc:MGI:104680] |
| Percent Identity: | 82.89 % |
| Parental protein coverage: | 73.53 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VTKGGIMLPEKSQGKVLQATVVA-VGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDG |
| .TKGGIMLPEKSQGKVL.ATVVA.VG.GSKGKGGEIQPVSVKVGDKVLLPEYGGT.VVLD.K.YF.FR.. | |
| Retrocopy | LTKGGIMLPEKSQGKVLRATVVA>VGLGSKGKGGEIQPVSVKVGDKVLLPEYGGTVVVLDNKGYFSFRND |
| Parental | DILGKY |
| ..LGK. | |
| Retrocopy | ETLGKH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |