RetrogeneDB ID: | retro_cpor_273 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_112:3986308..3986508(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HSPE1 | ||
| Ensembl ID: | ENSCPOG00000027474 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.88 % |
| Parental protein coverage: | 64.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | EKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLD-DKDYF-LFRDGDILGKY |
| .K...K...AT.....S..KGKGG.IQPVS.K..DK.L.P.Y.GTKVVL...KD.F.LFRD.DI..KY | |
| Retrocopy | KKALRKTTEATITVA*SVFKGKGGQIQPVSLKSEDKILFPKYEGTKVVLN>EKDLF>LFRDDDIFRKY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 30 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 149 .60 RPM |
| SRP017611_liver | 0 .00 RPM | 94 .84 RPM |
| SRP040447_lung | 0 .00 RPM | 27 .26 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 44 .11 RPM |