RetrogeneDB ID: | retro_dnov_791 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_107962:2996..3263(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPS7 | ||
| Ensembl ID: | ENSDNOG00000013285 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S7 [Source:HGNC Symbol;Acc:10440] |
| Percent Identity: | 80.9 % |
| Parental protein coverage: | 52.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | LEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQVRLVRELEKKFSGKHVVFIAQRR |
| LEMNSDLK..LR.LNITAAKE.EVGGG.KA..IFVP.PQLK.FQKIQV..V.ELEKKFSGKH.VFI..R. | |
| Retrocopy | LEMNSDLKTHLRDLNITAAKETEVGGGWKATVIFVPLPQLKYFQKIQVQVVCELEKKFSGKHAVFIV*RK |
| Parental | ILPKPTRKSRTKNKQKRPR |
| ILPKPTRKS.TKNKQKRPR | |
| Retrocopy | ILPKPTRKSHTKNKQKRPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 19 .25 RPM | 133 .60 RPM |
| SRP012922_cerebellum | 7 .15 RPM | 58 .70 RPM |
| SRP012922_heart | 10 .67 RPM | 106 .04 RPM |
| SRP012922_kidney | 16 .70 RPM | 137 .45 RPM |
| SRP012922_liver | 7 .59 RPM | 71 .99 RPM |
| SRP012922_lung | 17 .87 RPM | 156 .85 RPM |
| SRP012922_quadricep_muscle | 15 .06 RPM | 136 .74 RPM |
| SRP012922_spleen | 32 .16 RPM | 224 .12 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016462 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013285 | 14 retrocopies | |
| Equus caballus | ENSECAG00000020253 | 2 retrocopies | |
| Felis catus | ENSFCAG00000023243 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023095 | 13 retrocopies | |
| Loxodonta africana | ENSLAFG00000015087 | 11 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006121 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000011870 | 7 retrocopies | |
| Mus musculus | ENSMUSG00000061477 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000015407 | 10 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008507 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000028165 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025872 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000011615 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002071 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008551 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000027353 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024830 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001616 | 6 retrocopies |