RetrogeneDB ID: | retro_dnov_607 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_6759:650902..651130(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HSBP1 | ||
| Ensembl ID: | ENSDNOG00000015303 | ||
| Aliases: | None | ||
| Description: | heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:5203] |
| Percent Identity: | 79.22 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MAETDPKTVQDLTSVVKTLVQQMQDKFQTMSDQIIGRTLDDMSSRIDDLEKNIADLMTQAGVEELEGENK |
| .A.TDP..V.DLT.VVKT..QQM.DKFQ.MSDQIIGR..DDMSS.ID.LEKNIA.LMTQAGVEELEGENK | |
| Retrocopy | IAKTDPRAVLDLTLVVKTPLQQMRDKFQIMSDQIIGR-IDDMSSHIDELEKNIANLMTQAGVEELEGENK |
| Parental | IPATQKS |
| .PATQKS | |
| Retrocopy | MPATQKS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 99 .96 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 73 .82 RPM |
| SRP012922_heart | 0 .00 RPM | 67 .06 RPM |
| SRP012922_kidney | 0 .00 RPM | 80 .50 RPM |
| SRP012922_liver | 0 .00 RPM | 46 .44 RPM |
| SRP012922_lung | 0 .00 RPM | 66 .74 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 82 .39 RPM |
| SRP012922_spleen | 0 .00 RPM | 69 .59 RPM |