RetrogeneDB ID: | retro_dnov_478 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_5157:75406..75570(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000018469 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.89 % |
| Parental protein coverage: | 62.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MPKR-KAEGDVKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGK |
| MPKR....G..K..K........R...RL.AKPAPPKPE.KP.K.PAKKG.KVPKGK | |
| Retrocopy | MPKR<RLKGMLKEIKSR*RIN-NRILIRLTAKPAPPKPELKPEKDPAKKGGKVPKGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 171 .91 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 56 .64 RPM |
| SRP012922_heart | 0 .00 RPM | 37 .82 RPM |
| SRP012922_kidney | 0 .00 RPM | 69 .27 RPM |
| SRP012922_liver | 0 .00 RPM | 25 .23 RPM |
| SRP012922_lung | 0 .00 RPM | 112 .56 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 29 .94 RPM |
| SRP012922_spleen | 0 .00 RPM | 232 .70 RPM |