RetrogeneDB ID: | retro_dnov_434 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_4660:38730..39078(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PLA2G12A | ||
| Ensembl ID: | ENSDNOG00000016573 | ||
| Aliases: | None | ||
| Description: | phospholipase A2, group XIIA [Source:HGNC Symbol;Acc:18554] |
| Percent Identity: | 58.2 % |
| Parental protein coverage: | 64.17 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | GSKPFPHYDYKPSPPNGCGSPMFGV-HLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRN |
| G.KPFP...YKPSP..G.GSP..GV.HL..G.PSLTKCC..H..C.....KS..D.DE.FQ..L.KIC.. | |
| Retrocopy | GPKPFPRCAYKPSPAKGRGSPLLGV>HLLVGVPSLTKCCKGHESC----SKSEQDGDEGFQARLAKICGL |
| Parental | VQKTLGLAQHVQACETTVELLFGSVIHLGCKPYLDSQRAAC-RCRYEEKTDL |
| .Q.T.G.A.HV.A.ETT..LL.GSV...G.KPY.DSQ.AAC.RC..E.KTDL | |
| Retrocopy | GQETRGPAPHVGAGETTAALLSGSVARFGSKPYQDSQGAAC<RCHCEGKTDL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 14 .59 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 14 .30 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .94 RPM |
| SRP012922_kidney | 0 .00 RPM | 12 .87 RPM |
| SRP012922_liver | 0 .00 RPM | 18 .73 RPM |
| SRP012922_lung | 0 .00 RPM | 9 .77 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 10 .56 RPM |
| SRP012922_spleen | 0 .00 RPM | 13 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000015230 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016169 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000016573 | 7 retrocopies |
retro_dnov_1694, retro_dnov_172, retro_dnov_1856, retro_dnov_1930, retro_dnov_2286, retro_dnov_2572, retro_dnov_434 ,
|
| Homo sapiens | ENSG00000123739 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001082 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000000852 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008637 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000027999 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004686 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014505 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000016362 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009139 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000004756 | 4 retrocopies | |
| Vicugna pacos | ENSVPAG00000009842 | 1 retrocopy |