RetrogeneDB ID: | retro_dnov_367 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_4092:174560..174787(+) | ||
| Located in intron of: | ENSDNOG00000017625 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000007732 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.84 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SVPSLAAGLFFGGLAGL-GAYQLSQDPRNVWVFLVTSGTLAGIMGMRFYHSGKFMPAGLIAGVSLLMVAK |
| SVPS.AA.L.FGGLAGL.GAYQLSQDP.N.WVFL..SGT.AG..GMRFY..GK.MPAG.I....LL.VAK | |
| Retrocopy | SVPSPAARLYFGGLAGL<GAYQLSQDPGNIWVFLAASGTSAGNTGMRFYYFGKCMPAGAI----LLIVAK |
| Parental | LGISMFNGPHQ |
| LGISM.N.PHQ | |
| Retrocopy | LGISMLNRPHQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 45 .89 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 20 .76 RPM |
| SRP012922_heart | 0 .00 RPM | 30 .86 RPM |
| SRP012922_kidney | 0 .00 RPM | 84 .33 RPM |
| SRP012922_liver | 0 .00 RPM | 86 .23 RPM |
| SRP012922_lung | 0 .00 RPM | 41 .54 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 22 .67 RPM |
| SRP012922_spleen | 0 .11 RPM | 188 .63 RPM |