RetrogeneDB ID: | retro_dnov_329 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_3679:52970..53402(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TPM3 | ||
| Ensembl ID: | ENSDNOG00000019156 | ||
| Aliases: | None | ||
| Description: | tropomyosin 3 [Source:HGNC Symbol;Acc:12012] |
| Percent Identity: | 53.74 % |
| Parental protein coverage: | 67.92 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | QEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA-ADESERGMKVIENRALK |
| .E..........D.......LNRR.Q.VEEELDRA.E..ATAL.KL.EAE...A.ESERG......R... | |
| Retrocopy | EERAQTRGASGSDRPGPCGALNRRVQPVEEELDRAREWPATALRKLAEAERR<AGESERG*R*SRTRP*R |
| Parental | DEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDFR-TEERAELAESKCSEL-EEELKNVTNNLK |
| ........E.QLKEAKH.AEEAD.K..EVARK.VI.EG.....EERAE..E.KC..L..EELKNVTNNL. | |
| Retrocopy | TRRRWR-SEMQLKEAKHSAEEADCKHGEVARKSVILEGELEGAEERAEVSELKCGDL>GEELKNVTNNLR |
| Parental | SLEAAEK |
| SLEAA.. | |
| Retrocopy | SLEAASE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 82 .84 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 22 .27 RPM |
| SRP012922_heart | 0 .00 RPM | 3 .71 RPM |
| SRP012922_kidney | 0 .00 RPM | 15 .33 RPM |
| SRP012922_liver | 0 .00 RPM | 12 .07 RPM |
| SRP012922_lung | 0 .00 RPM | 59 .56 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 2754 .12 RPM |
| SRP012922_spleen | 0 .00 RPM | 42 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011877 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000033217 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000017311 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000007279 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019156 | 7 retrocopies |
retro_dnov_1322, retro_dnov_1767, retro_dnov_329 , retro_dnov_451, retro_dnov_848, retro_dnov_878, retro_dnov_944,
|
| Equus caballus | ENSECAG00000010942 | 1 retrocopy | |
| Felis catus | ENSFCAG00000012596 | 1 retrocopy | |
| Homo sapiens | ENSG00000143549 | 9 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013331 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010805 | 10 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007875 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000027940 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000011821 | 2 retrocopies |