RetrogeneDB ID: | retro_dnov_2665 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_96191:9773..10040(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR3 | ||
| Ensembl ID: | ENSDNOG00000025421 | ||
| Aliases: | None | ||
| Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [Source:HGNC Symbol;Acc:15606] |
| Percent Identity: | 80.9 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | ANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQXXQFNRLPLVVSSIASSNANTGLIVS |
| ANDNAPEHALR.G.LSTFALATD.GSKLGLSKNKSIICYY.TY...QFNRLPLVV..IASS.ANTGLI.S | |
| Retrocopy | ANDNAPEHALRLGILSTFALATDEGSKLGLSKNKSIICYYSTY*VVQFNRLPLVVNFIASSSANTGLIIS |
| Parental | LEKELAPLFEELRQVVEVS |
| LEKEL..L..ELR.V.EVS | |
| Retrocopy | LEKELHVLQ*ELRLVLEVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 1 .17 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .96 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .46 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .10 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .31 RPM |
| SRP012922_lung | 0 .15 RPM | 1 .07 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .35 RPM |
| SRP012922_spleen | 0 .11 RPM | 1 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000995 | 4 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013153 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015196 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000013304 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000025421 | 14 retrocopies | |
| Dipodomys ordii | ENSDORG00000015501 | 5 retrocopies | |
| Equus caballus | ENSECAG00000013569 | 1 retrocopy | |
| Homo sapiens | ENSG00000109270 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001132 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000015740 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006786 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006830 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000020688 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000091512 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013684 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000014955 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016310 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017674 | 1 retrocopy |