RetrogeneDB ID: | retro_dnov_2616 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_90959:3660..4076(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSDNOG00000009992 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CDV3 | ||
| Ensembl ID: | ENSDNOG00000010208 | ||
| Aliases: | None | ||
| Description: | CDV3 homolog (mouse) [Source:HGNC Symbol;Acc:26928] |
| Percent Identity: | 97.86 % |
| Parental protein coverage: | 78.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | PGDNWEEGGGGGGGVE-KSSGPWNKTAVVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPE |
| PGDNWEE.GGGGGGVE.KSSGPWNKTAVVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPE | |
| Retrocopy | PGDNWEEDGGGGGGVE<KSSGPWNKTAVVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPE |
| Parental | IYSDTQFPSLQSTAKHAESRKDKEMEKSFEVVRHKNRGRDEVPKNQALKLQLDNQYAVLENQKSSHTQYN |
| IYSDTQFPSLQSTAKHAESRKDKEMEKSFEVVRHKNRGRDEVPKNQALKLQLDNQYAVLENQKSSHTQY. | |
| Retrocopy | IYSDTQFPSLQSTAKHAESRKDKEMEKSFEVVRHKNRGRDEVPKNQALKLQLDNQYAVLENQKSSHTQYS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 5 .45 RPM | 26 .64 RPM |
| SRP012922_cerebellum | 2 .75 RPM | 13 .47 RPM |
| SRP012922_heart | 9 .05 RPM | 38 .29 RPM |
| SRP012922_kidney | 7 .94 RPM | 30 .67 RPM |
| SRP012922_liver | 5 .42 RPM | 20 .28 RPM |
| SRP012922_lung | 4 .28 RPM | 23 .67 RPM |
| SRP012922_quadricep_muscle | 15 .40 RPM | 48 .46 RPM |
| SRP012922_spleen | 7 .44 RPM | 33 .88 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
| Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
| Equus caballus | ENSECAG00000015689 | 2 retrocopies | |
| Homo sapiens | ENSG00000091527 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000009864 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032803 | 10 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003470 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000012748 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000025898 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011637 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011401 | 2 retrocopies |