RetrogeneDB ID: | retro_dnov_2548 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_84871:2135..2477(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ZCCHC17 | ||
| Ensembl ID: | ENSDNOG00000000509 | ||
| Aliases: | None | ||
| Description: | zinc finger, CCHC domain containing 17 [Source:HGNC Symbol;Acc:30246] |
| Percent Identity: | 56.3 % |
| Parental protein coverage: | 51.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | MKNDRIKVSLSMKVVNQGTGKDLDPNNVIIEQEERRSGPSQDYTGQKITLEAVLNTTCKKCGCK-GHFAK |
| MKN.RIKVSLSMKVV.QGTGK.LD.N..I.EQE.......QDYTGQ.I.LEA..N.T.KKCG.K...FAK | |
| Retrocopy | MKNHRIKVSLSMKVVKQGTGKYLDTNYIITEQEKKQRWSFQDYTGQ-IILEAAQNITFKKCGSK<VYFAK |
| Parental | DCFMQPGGTKYS-LIPDEEEEKQEAKSAEFEKPDPTKNSSRKRKKEKKK |
| DCF.Q....KYS.....EEE.....KS.EFE...P..NS.RK.....K. | |
| Retrocopy | DCFIQLEVKKYS>IPDEEEEKRD--KSTEFEETSPMRNSPRKERGKRKE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 11 .47 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 40 .14 RPM |
| SRP012922_heart | 0 .00 RPM | 11 .83 RPM |
| SRP012922_kidney | 0 .00 RPM | 14 .24 RPM |
| SRP012922_liver | 0 .00 RPM | 3 .41 RPM |
| SRP012922_lung | 0 .00 RPM | 28 .25 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 6 .92 RPM |
| SRP012922_spleen | 0 .00 RPM | 22 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017710 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000016818 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000011131 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000000509 | 1 retrocopy |
retro_dnov_2548 ,
|
| Dipodomys ordii | ENSDORG00000004128 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007421 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000015364 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000594 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017082 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015442 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028772 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013749 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000007944 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003825 | 1 retrocopy |