RetrogeneDB ID: | retro_dnov_1607 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_246723:306..663(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL11 | ||
| Ensembl ID: | ENSDNOG00000004111 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L11 [Source:HGNC Symbol;Acc:14042] |
| Percent Identity: | 58.2 % |
| Parental protein coverage: | 62.5 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | RGVSISQFCKEFNEKTKDIIEGIPLPTKIFVKPDRTFEIKIGQ-PTVSYFLKAAAGIEKGARQTGKEVAG |
| RG.S.SQ.CKEFN.KTK...EGIPLP.KI..KPDRTFEIK.GQ.P....F.........G.....K.VAG | |
| Retrocopy | RGTSTSQCCKEFNKKTKGTTEGIPLPIKISAKPDRTFEIKTGQ>PLFPAFWRQLLILRRGPGRQRK-VAG |
| Parental | LVTLKHVYEIARIKAQDDAF-ALQDVPLSSVVRSIIGSARSLGIRVVKDLSS |
| LVTLKH..E.A..KAQDDA...LQD.PLSS.V.S.I.SA.SLG..V.K.L.. | |
| Retrocopy | LVTLKHRHEVAHVKAQDDAL<SLQDMPLSSAVHSLIDSAYSLGFPVLKELAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 41 .62 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 20 .76 RPM |
| SRP012922_heart | 0 .00 RPM | 33 .18 RPM |
| SRP012922_kidney | 0 .00 RPM | 53 .94 RPM |
| SRP012922_liver | 0 .00 RPM | 27 .87 RPM |
| SRP012922_lung | 0 .00 RPM | 22 .76 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 41 .89 RPM |
| SRP012922_spleen | 0 .00 RPM | 21 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000012706 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001470 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004111 | 2 retrocopies |
retro_dnov_1607 , retro_dnov_566,
|
| Echinops telfairi | ENSETEG00000015216 | 2 retrocopies | |
| Homo sapiens | ENSG00000174547 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001300 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004047 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024902 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006111 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010448 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000003025 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003924 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000025971 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008712 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002678 | 1 retrocopy |