RetrogeneDB ID: | retro_dnov_1450 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_206422:3863..4166(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFAB1 | ||
| Ensembl ID: | ENSDNOG00000017122 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa [Source:HGNC Symbol;Acc:7694] |
| Percent Identity: | 67.33 % |
| Parental protein coverage: | 64.74 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | SVAFTPLPLAPRLFAARPLSIALCPAGIRTGLVVLQPVSVLTQVPGKVTQLCRQYSDAPPLTLEGIKDRV |
| S..F...P.....F.A..LSIAL...GI.TGLV..Q.VSVLTQVPGKVT.LC.QYSD.PPLTLEGIKDRV | |
| Retrocopy | SCSFYLCPPPVHGFYAAQLSIALSSTGIQTGLVAPQTVSVLTQVPGKVT*LCLQYSDVPPLTLEGIKDRV |
| Parental | LYVLKLYDKIDPEKXXXXXHFMKDLGLDSLD |
| LYVLK..DKI.PEK.....HFMKDL.LDS.D | |
| Retrocopy | LYVLKFCDKIGPEKLSVNSHFMKDLDLDS*D |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 60 .87 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 29 .69 RPM |
| SRP012922_heart | 0 .00 RPM | 119 .03 RPM |
| SRP012922_kidney | 0 .00 RPM | 61 .60 RPM |
| SRP012922_liver | 0 .00 RPM | 24 .61 RPM |
| SRP012922_lung | 0 .00 RPM | 22 .60 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 106 .27 RPM |
| SRP012922_spleen | 0 .00 RPM | 24 .15 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014304 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017667 | 3 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003558 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020616 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012038 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000017122 | 5 retrocopies | |
| Felis catus | ENSFCAG00000013241 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000001032 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012681 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000020522 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016352 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000012142 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000030869 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005562 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018129 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000010795 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005258 | 2 retrocopies |