RetrogeneDB ID: | retro_cpor_941 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_35:16251263..16251482(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CKS1B | ||
| Ensembl ID: | ENSCPOG00000024061 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.27 % |
| Parental protein coverage: | 90.12 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 0 |
| Parental | YYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFRRPLPKK |
| ...D...D.EF..RHVML.KDI..LVPKTHLM..SE.R.LG.QQSQGWV...IHE.EPHI.....PL..K | |
| Retrocopy | HF*DQ*NDVEFK*RHVMLSKDIVNLVPKTHLMNVSE*RILGDQQSQGWVPHIIHETEPHIWVS*WPLTMK |
| Parental | PNK |
| PN. | |
| Retrocopy | PNE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 1 .67 RPM |
| SRP017611_kidney | 0 .00 RPM | 7 .43 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .79 RPM |
| SRP040447_lung | 0 .00 RPM | 7 .19 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 3 .26 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000033635 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000024061 | 2 retrocopies |
retro_cpor_859, retro_cpor_941 ,
|
| Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
| Homo sapiens | ENSG00000173207 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013419 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002408 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000004796 | 1 retrocopy |