RetrogeneDB ID: | retro_cpor_934 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_35:3857276..3857698(-) | ||
| Located in intron of: | ENSCPOG00000011562 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CCDC90A | ||
| Ensembl ID: | ENSCPOG00000014899 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.34 % |
| Parental protein coverage: | 65.16 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected | 1 |
| Parental | ELSLSAPCLQLEHRRTGFTSPGHQKLYFDTHALVCLLEANGFTTQQAEIIASALVKIMEANVDIVYKDMV |
| .LSLSA..LQL.H.RT.F.S...Q.LYF.THALVCL.E.NGFTTQQAE.I.S.L.KIMEA...IVYK.M. | |
| Retrocopy | KLSLSAQYLQL*HKRTDFISLRNQTLYFNTHALVCLVEKNGFTTQQAESIVSVLFKIMEA---IVYKNMI |
| Parental | TKVQQEITLQQIMSKISNVKKDMIILEKSEFSALRAENEKIKLELHQLKQ-QVTDEVIKVRTDTKLDFNL |
| TKV.QE..LQ..MSKI.N.KKD.IIL.KS.F.ALRAENEK..L.LHQLKQ....DEVIKV.TDTKL.FNL | |
| Retrocopy | TKV*QEMSLQ*TMSKIANMKKDTIILKKSKF*ALRAENEKKELKLHQLKQ<KEMDEVIKV*TDTKLEFNL |
| Parental | EKSRV |
| EKSRV | |
| Retrocopy | EKSRV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 16 .45 RPM |
| SRP017611_kidney | 0 .00 RPM | 61 .14 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .22 RPM |
| SRP040447_lung | 0 .00 RPM | 11 .40 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 11 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000395 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009857 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016050 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000014899 | 1 retrocopy |
retro_cpor_934 ,
|
| Equus caballus | ENSECAG00000009150 | 2 retrocopies | |
| Felis catus | ENSFCAG00000005972 | 3 retrocopies | |
| Homo sapiens | ENSG00000050393 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002632 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003287 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000000183 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010975 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000698 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000914 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013458 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000017740 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012562 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012874 | 1 retrocopy |