RetrogeneDB ID: | retro_cpor_862 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:57514166..57514589(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNAP23 | ||
| Ensembl ID: | ENSCPOG00000003638 | ||
| Aliases: | None | ||
| Description: | Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:H0V1C5] |
| Percent Identity: | 58.62 % |
| Parental protein coverage: | 67.3 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 3 |
| Parental | ETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKAAWGEGG-GNSPSNVVSKQPA-RVTNGQPQQPATGAV |
| E....LTELNKC...CVC.CNRTKNFESGK.YKA.W..G..G..P.N.VSKQPA.RV...QP...A.... | |
| Retrocopy | ERQRKLTELNKCYSFCVCLCNRTKNFESGKTYKATW*DGE<GSAPWNLVSKQPA<RVSSKQPTPQAREQP |
| Parental | SGG-YIKRITNDAKEEEMEENLTQVGNILGNLKNLALDMGNEIDAQNRQIDSITKKVEANKDRIDIANTR |
| .GG.Y.K..TND..E.EMEE.LTQV.N.L.NLKN.A..MG.E..AQN.QI..I..K...N...IDI.NTR | |
| Retrocopy | IGG<YVKGTTNDTREDEMEEKLTQVKNSLRNLKNVAWGMGSETKAQNQQINWIIEKADTNNYHIDISNTR |
| Parental | AKKLI |
| AKK.I | |
| Retrocopy | AKKPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .61 RPM |
| SRP017611_kidney | 0 .00 RPM | 18 .53 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .98 RPM |
| SRP040447_lung | 0 .00 RPM | 31 .65 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 14 .36 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000015685 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000015774 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000005661 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000011105 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000006468 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000003638 | 1 retrocopy |
retro_cpor_862 ,
|
| Felis catus | ENSFCAG00000013387 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000005462 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000813 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000017889 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000009856 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000027287 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000050552 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006589 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002561 | 1 retrocopy |