RetrogeneDB ID: | retro_cpor_852 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:23881556..23881888(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1G1 | ||
| Ensembl ID: | ENSCPOG00000000763 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864] |
| Percent Identity: | 53.85 % |
| Parental protein coverage: | 96.58 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 4 |
| Parental | SQGIQQLLQ-AEKRAAEKVSEARKRKNRRLKQAKEEA-QAEIEQYRLQREKEFKAKEAAALGSHGSCSSE |
| ..GIQQL...AE....EK...A...K..RLK.A.E.A...E..Q..LQ.EK.FKA..A.ALG...SCS.E | |
| Retrocopy | TRGIQQLRR<AEILTSEKLAQALTGKKQRLK*AEETA<SPEMGQHGLQSEKKFKAEDAEALGGRDSCSPE |
| Parental | VEKETQEKMAVLQHYFQQNRE-EVLD-NLLAFVCDIRPEIHENYRIN |
| .E.ETQEKMA.L..YF....E.EVL...LLAFVCDI.P.IHEN...N | |
| Retrocopy | TE-ETQEKMALLETYFWNTAE<EVLE<TLLAFVCDIWP*IHENSCMN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 8 .11 RPM |
| SRP017611_kidney | 0 .00 RPM | 20 .41 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .15 RPM |
| SRP040447_lung | 0 .00 RPM | 28 .85 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 20 .58 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000020461 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000000763 | 5 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008083 | 15 retrocopies | |
| Dipodomys ordii | ENSDORG00000014850 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000013437 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008657 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000004899 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019574 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000039105 | 5 retrocopies |