RetrogeneDB ID: | retro_cpor_367 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_133:1120013..1120257(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CDC42SE2 | ||
| Ensembl ID: | ENSCPOG00000005142 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 51.22 % |
| Parental protein coverage: | 96.43 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | FWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTA-HVGSGDLFSGMNSVSLMQSKGGYGGGVGGGVQV |
| F....NCCIAEQPQPK..R..D..MI.EPTNFV..A..VG....FS.MNSVS.........G..G.G... | |
| Retrocopy | FLXXXNCCIAEQPQPKKWRQTDQNMIREPTNFVYMA>FVGLREMFSRMNSVSSI*NQMQSKGCYGRGMAA |
| Parental | QVQMQLVDTKAG |
| ..Q.QL..TKAG | |
| Retrocopy | NMQLQLMYTKAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 18 .58 RPM |
| SRP017611_kidney | 0 .00 RPM | 11 .10 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .18 RPM |
| SRP040447_lung | 0 .00 RPM | 17 .25 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 5 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000008774 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000005142 | 1 retrocopy |
retro_cpor_367 ,
|
| Rattus norvegicus | ENSRNOG00000042449 | 2 retrocopies |