RetrogeneDB ID: | retro_chof_1622 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_343766:166..395(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CDC42SE2 | ||
| Ensembl ID: | ENSCHOG00000008774 | ||
| Aliases: | None | ||
| Description: | CDC42 small effector 2 [Source:HGNC Symbol;Acc:18547] |
| Percent Identity: | 62.65 % |
| Parental protein coverage: | 97.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | FWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMSA- |
| FWLCF...IAEQP..KRRR.ID.......T...HTAHVGSGDLFSG..SVS.IQNQ.Q.K...GGGMSA. | |
| Retrocopy | FWLCFLRGIAEQP--KRRRGIDI*LVSQQT--AHTAHVGSGDLFSGTSSVSFIQNQTQYKVRSGGGMSA< |
| Parental | NVQ-MKLMETKAG |
| NV....L..TKAG | |
| Retrocopy | NVH<LQLEDTKAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000008774 | 1 retrocopy |
retro_chof_1622 ,
|
| Cavia porcellus | ENSCPOG00000005142 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042449 | 2 retrocopies |