RetrogeneDB ID: | retro_cpor_365 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_132:2685773..2685992(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | KIAA0101 | ||
| Ensembl ID: | ENSCPOG00000006482 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.6 % |
| Parental protein coverage: | 65.18 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | RTKADSVPGTYRKVVASRAPRKVLGPSTSATNSRAFSSSRKAENKYSGGNPVCVRPTPKWQKGIGEFFRL |
| R....SVP.TYRKVVAS.AP.KVLG...S.TNS...SSSRKAENKYSG.NPVCV..T.K.Q.GIGEFFRL | |
| Retrocopy | RAN*SSVPSTYRKVVAS*APKKVLGCPASITNSTPLSSSRKAENKYSGRNPVCVHSTLKGQNGIGEFFRL |
| Parental | SPK |
| SPK | |
| Retrocopy | SPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .29 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .04 RPM |
| SRP040447_lung | 0 .00 RPM | 2 .14 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 0 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000010763 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000006482 | 3 retrocopies |
retro_cpor_138, retro_cpor_186, retro_cpor_365 ,
|
| Dipodomys ordii | ENSDORG00000014912 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000027710 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000040204 | 7 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003982 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000016561 | 5 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000019643 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013732 | 2 retrocopies |