RetrogeneDB ID: | retro_cpor_1142 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_5:47983476..47983773(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C1ORF123 | ||
| Ensembl ID: | ENSCPOG00000011509 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.19 % |
| Parental protein coverage: | 61.88 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 4 |
| Parental | KIALQLKATLENITN-LRPLGEDFRWYLKMKCGNCGEIS-EKWQY-IRLMDSVALKGGRGSASMVQKCKL |
| K..LQL...L.N.TN.L.PLGED..W.LKMKCGNCGEI..EKWQ....L.DSV.L..G..SAS...K.KL | |
| Retrocopy | KTMLQLTVVLKNTTN<LQPLGEDLWWFLKMKCGNCGEIL>EKWQH>DELTDSVVLTRGHDSASVAHKYKL |
| Parental | -CARENSIEILSSTIKPYNAEDNEKFKTIVEFE |
| ..A.EN..EILSSTI....AED..KFKTIV.F. | |
| Retrocopy | <VAWENFTEILSSTIRSCTAEDGKKFKTIVKFK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 38 .82 RPM |
| SRP017611_kidney | 0 .00 RPM | 19 .68 RPM |
| SRP017611_liver | 0 .00 RPM | 21 .85 RPM |
| SRP040447_lung | 0 .00 RPM | 22 .82 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 12 .98 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy |
retro_cpor_1142 ,
|
| Homo sapiens | ENSG00000162384 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |