RetrogeneDB ID: | retro_cjac_3186 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:18514000..18514328(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000007832 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | C1orf123 | ||
| Ensembl ID: | ENSCJAG00000004526 | ||
| Aliases: | None | ||
| Description: | chromosome 1 open reading frame 123 [Source:HGNC Symbol;Acc:26059] |
| Percent Identity: | 90.18 % |
| Parental protein coverage: | 69.18 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | SVALK-GGRGSASMVQKCKLCARENSIDILSSTIKPYNAEDNENFKTIVEFECR-GLEPVDFQPQAGFAA |
| SVAL...GRGSAS.VQKC.LCARENSI.ILSSTIKPYNAED.ENFKTIVEFE...GLEP.DFQPQAGFAA | |
| Retrocopy | SVALE<AGRGSASTVQKCRLCARENSIEILSSTIKPYNAEDDENFKTIVEFEWE<GLEPIDFQPQAGFAA |
| Parental | EGVESGTVFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC |
| EGVESGTVFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC | |
| Retrocopy | EGVESGTVFSDINLQEKDWTDYDEKAQESVGIYEVTHQFVKC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 6 .06 RPM |
| SRP051959_heart | 0 .02 RPM | 7 .72 RPM |
| SRP051959_kidney | 0 .04 RPM | 11 .83 RPM |
| SRP051959_liver | 0 .04 RPM | 10 .03 RPM |
| SRP051959_lung | 0 .05 RPM | 8 .02 RPM |
| SRP051959_lymph_node | 0 .07 RPM | 10 .43 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 12 .03 RPM |
| SRP051959_spleen | 0 .02 RPM | 8 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004526 | 3 retrocopies |
retro_cjac_2948, retro_cjac_3149, retro_cjac_3186 ,
|
| Cavia porcellus | ENSCPOG00000011509 | 1 retrocopy | |
| Homo sapiens | ENSG00000162384 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004027 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006397 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000002439 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028608 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017988 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000029317 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013324 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009003 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001336 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000000752 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000012724 | 3 retrocopies |