RetrogeneDB ID: | retro_cjac_3948 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | GL286373.1:198356..198669(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DNPH1 | ||
| Ensembl ID: | ENSCJAG00000005337 | ||
| Aliases: | None | ||
| Description: | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 [Source:HGNC Symbol;Acc:21218] |
| Percent Identity: | 64.81 % |
| Parental protein coverage: | 60.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | EEAAGDDRLIHEQDLAWLQQADRVVAEVTQPSLGVGYELGRAVALN-KRILCLFRPQSGRVLSAMIRGAA |
| ..AAG.DRLIHEQ.LAWL.QA..VVAEV.QPSLG.GYELG.A.AL....IL....PQSGRVL.AMI...A | |
| Retrocopy | DKAAGGDRLIHEQYLAWLLQANVVVAEVKQPSLGAGYELGQAMALH<QLILFVLQPQSGRVLLAMIWATA |
| Parental | DGSRIQVWDYEE-GEVEALLDRYFEADPPGQVAASPDP |
| DGS..QVW.Y...G.VE.LLD...EA.PP.QV.ASP.P | |
| Retrocopy | DGSGFQVWSYGQ<GRVEVLLDGKAEAEPPEQV-ASPNP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 1 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .33 RPM |
| SRP051959_kidney | 0 .04 RPM | 0 .42 RPM |
| SRP051959_liver | 0 .35 RPM | 0 .80 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .13 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 0 .41 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .09 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012390 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000019913 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005337 | 1 retrocopy |
retro_cjac_3948 ,
|
| Equus caballus | ENSECAG00000006660 | 1 retrocopy | |
| Felis catus | ENSFCAG00000009722 | 1 retrocopy | |
| Homo sapiens | ENSG00000112667 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000516 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016635 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029662 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008743 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018397 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007022 | 1 retrocopy |