RetrogeneDB ID: | retro_cfam_1148 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 24:27714089..27714329(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DNPH1 | ||
| Ensembl ID: | ENSCAFG00000001837 | ||
| Aliases: | None | ||
| Description: | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 [Source:HGNC Symbol;Acc:21218] |
| Percent Identity: | 56.47 % |
| Parental protein coverage: | 54.48 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 3 |
| Parental | EEAAG-GDRFIYER-DLAWLQQADVVVAEVT-QPSLGVGYELGQAMALNKRILCLFRP--QSGRVL-SAM |
| EEAAG.G.R.I.....LAWL.QA..V.A.VT..P....G.ELGQ..AL.KRILCL.RP..QSG.VL.S.. | |
| Retrocopy | EEAAG<GPRLIHRG<GLAWLRQAHLVMAAVTLHPQVHQGCELGQPVALSKRILCLSRPPQQSGQVL<SIR |
| Parental | IRGAADGSRFQVLDY |
| .RG.A.G..F.V.DY | |
| Retrocopy | PRGTA-GWPF*V*DY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 1 .39 RPM |
| SRP017611_brain | 0 .00 RPM | 0 .32 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .20 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Equus caballus | retro_ecab_595 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012390 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000019913 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001837 | 1 retrocopy |
retro_cfam_1148 ,
|
| Callithrix jacchus | ENSCJAG00000005337 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006660 | 1 retrocopy | |
| Felis catus | ENSFCAG00000009722 | 1 retrocopy | |
| Homo sapiens | ENSG00000112667 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000516 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016635 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029662 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008743 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018397 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007022 | 1 retrocopy |