RetrogeneDB ID: | retro_cjac_3748 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | ACFV01198393.1:1606..1807(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000035758 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.62 % |
| Parental protein coverage: | 67. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | DSPASASRVAGITGMCYHTQLILMYILLET-GFHHVGQVDLKLLSSSD-LPTLASQSAGITGMSHHAQP |
| D.P..AS.VAG.TG.C....LI.....L.T.G.H.V.Q.DL..LSS...LPTLAS.SA.IT.M.H..QP | |
| Retrocopy | DPPTLAS*VAGTTGVCHQG*LIFVISFL*T>GSHCVVQADLEFLSSTS<LPTLASESARITSMRHSTQP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .05 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .00 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .07 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 0 .00 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP051959_spleen | 0 .00 RPM | 0 .00 RPM |