RetrogeneDB ID: | retro_cjac_2660 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:122352585..122352909(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | POLR3K | ||
| Ensembl ID: | ENSCJAG00000011568 | ||
| Aliases: | None | ||
| Description: | DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:B0VX71] |
| Percent Identity: | 69.44 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAEPCP |
| .LLF.PGCGNGLI.EEGQ.C.RFAC.TCP.VHN.T.KVTNRKY.KLKE....LGGAAA.E..DSTA.PCP | |
| Retrocopy | LLLFYPGCGNGLIIEEGQHCCRFACGTCPCVHNVTHKVTNRKYSKLKEGANRLGGAAAREDADSTAGPCP |
| Parental | KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| ..E...AY.M..QTRSADEP.TTFY..C.AQCGH..R. | |
| Retrocopy | RGELLHAYCM*PQTRSADEPKTTFYQRCRAQCGHHRRE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 4 .70 RPM |
| SRP051959_heart | 0 .00 RPM | 2 .65 RPM |
| SRP051959_kidney | 0 .00 RPM | 2 .88 RPM |
| SRP051959_liver | 0 .00 RPM | 2 .45 RPM |
| SRP051959_lung | 0 .00 RPM | 3 .71 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 3 .95 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 1 .73 RPM |
| SRP051959_spleen | 0 .00 RPM | 3 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019715 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011568 | 1 retrocopy |
retro_cjac_2660 ,
|
| Echinops telfairi | ENSETEG00000009989 | 2 retrocopies | |
| Felis catus | ENSFCAG00000009110 | 2 retrocopies | |
| Homo sapiens | ENSG00000161980 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000015593 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000013608 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002526 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007525 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000530 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007970 | 1 retrocopy |