RetrogeneDB ID: | retro_cjac_2398 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 4:197308..197653(-) | ||
| Located in intron of: | ENSCJAG00000012363 | ||
Retrocopyinformation | Ensembl ID: | ENSCJAG00000012383 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TAF12 | ||
| Ensembl ID: | ENSCJAG00000009742 | ||
| Aliases: | None | ||
| Description: | TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [Source:HGNC Symbol;Acc:11545] |
| Percent Identity: | 85.22 % |
| Parental protein coverage: | 71.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | GGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDV |
| G...SPENNQVLTKKKLQ.LVREVDPNEQLDED.EE.LLQIADDFIES.VTAACQLAR..KSSTLEVKD. | |
| Retrocopy | GQEVSPENNQVLTKKKLQALVREVDPNEQLDEDEEETLLQIADDFIESAVTAACQLARRCKSSTLEVKDA |
| Parental | QLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK |
| QLH.ERQ.N..IPGFGSEEIRPYKKACTTEAHK.RMALIRKTT.. | |
| Retrocopy | QLHSERQRNTCIPGFGSEEIRPYKKACTTEAHKRRMALIRKTTHR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .69 RPM | 5 .64 RPM |
| SRP051959_heart | 0 .21 RPM | 6 .00 RPM |
| SRP051959_kidney | 0 .29 RPM | 6 .15 RPM |
| SRP051959_liver | 0 .13 RPM | 7 .32 RPM |
| SRP051959_lung | 0 .42 RPM | 10 .05 RPM |
| SRP051959_lymph_node | 0 .80 RPM | 10 .16 RPM |
| SRP051959_skeletal_muscle | 0 .09 RPM | 8 .43 RPM |
| SRP051959_spleen | 0 .55 RPM | 11 .72 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004366 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009742 | 1 retrocopy |
retro_cjac_2398 ,
|
| Cavia porcellus | ENSCPOG00000009044 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000015036 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000012597 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000914 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012595 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000010943 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015506 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000003935 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000001524 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000048288 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000007568 | 5 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005320 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005548 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000006779 | 1 retrocopy |