RetrogeneDB ID: | retro_cjac_2056 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 21:48890835..48891112(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SSR4 | ||
| Ensembl ID: | ENSCJAG00000011167 | ||
| Aliases: | None | ||
| Description: | signal sequence receptor, delta [Source:HGNC Symbol;Acc:11326] |
| Percent Identity: | 50.53 % |
| Parental protein coverage: | 53.76 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | YADVSGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKA-QRNNEDISIISPLFTVS |
| .ADV.........G...G..Q.S.S.....AH.G..E.R.F..ES.SLLR...QRN.EDIS.I..LFTV. | |
| Retrocopy | WADVRENSSFQSPGPRTGCSQLS*SMELQDAHLGASEMRCFEKESCSLLRRS<QRNFEDISAICSLFTVE |
| Parental | VDHRGTWN-GPWVSTEVLAAAIGLV |
| V.H.G.W..GPWVSTE.LAA.I.L. | |
| Retrocopy | VEHQGSWR<GPWVSTEALAATIYLM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .11 RPM | 31 .59 RPM |
| SRP051959_heart | 0 .14 RPM | 13 .75 RPM |
| SRP051959_kidney | 0 .04 RPM | 42 .07 RPM |
| SRP051959_liver | 0 .06 RPM | 39 .79 RPM |
| SRP051959_lung | 0 .08 RPM | 23 .86 RPM |
| SRP051959_lymph_node | 0 .02 RPM | 33 .51 RPM |
| SRP051959_skeletal_muscle | 0 .20 RPM | 11 .75 RPM |
| SRP051959_spleen | 0 .08 RPM | 41 .22 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2536 |
| Gorilla gorilla | retro_ggor_1585 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000011328 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000011167 | 1 retrocopy |
retro_cjac_2056 ,
|
| Dasypus novemcinctus | ENSDNOG00000025714 | 2 retrocopies | |
| Homo sapiens | ENSG00000180879 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000024329 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000006908 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008803 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013602 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006738 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000009037 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012784 | 1 retrocopy |