RetrogeneDB ID: | retro_cjac_1999 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 20:31123686..31124053(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TPRKB | ||
| Ensembl ID: | ENSCJAG00000004162 | ||
| Aliases: | None | ||
| Description: | TP53RK binding protein [Source:HGNC Symbol;Acc:24259] |
| Percent Identity: | 51.59 % |
| Parental protein coverage: | 78.98 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | QLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVA-ANKAVHLYKLGKM |
| QLT.QLD.FP.CRVT.LLF.D.K.A.DLRRK.......GSLIN..V..D.FQIL.A..NKAV..YK.GK. | |
| Retrocopy | QLTYQLDIFPKCRVTILLFEDTKSAEDLRRKVTKVIFSGSLINAVVTIDLFQILLA<INKAVYFYKVGKI |
| Parental | KTR-TLSTEIIYNLSPNNNISEALKKFGISGNDTSILIVYIEEGEKQINQEYLISQ |
| KTR.TL.TEII.N.SP.N.I.E..K..G.S..............EK.....YL... | |
| Retrocopy | KTR<TLGTEIIRNVSPTNIILET*KEIGLSKRHFNFIFFTLKR-EKKSRTFYLLTR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 5 .99 RPM |
| SRP051959_heart | 0 .00 RPM | 6 .51 RPM |
| SRP051959_kidney | 0 .00 RPM | 4 .88 RPM |
| SRP051959_liver | 0 .00 RPM | 5 .96 RPM |
| SRP051959_lung | 0 .00 RPM | 3 .38 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 4 .91 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 10 .02 RPM |
| SRP051959_spleen | 0 .00 RPM | 4 .03 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012021 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004162 | 3 retrocopies |
retro_cjac_1999 , retro_cjac_2867, retro_cjac_3065,
|
| Homo sapiens | ENSG00000144034 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009062 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000030805 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000016950 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000300 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016251 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000032893 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012292 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000012419 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000016406 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000014584 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000007934 | 2 retrocopies |