RetrogeneDB ID: | retro_cjac_1783 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 2:43152334..43152768(+) | ||
| Located in intron of: | ENSCJAG00000021314 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | APOOL | ||
| Ensembl ID: | ENSCJAG00000008249 | ||
| Aliases: | None | ||
| Description: | apolipoprotein O-like [Source:HGNC Symbol;Acc:24009] |
| Percent Identity: | 83.56 % |
| Parental protein coverage: | 55.13 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VGLVSARKGSKFKKITYPLGLATLGATVCYPVQSVIITKVTGK-KIYATSQQTFETVKSLWTKSNKKESL |
| .GLVSARK.SKFKKIT.PLGLATLGATVCYPVQSVII.KVTGK...YATSQQ....VKSLW.KS..KESL | |
| Retrocopy | MGLVSARKSSKFKKITHPLGLATLGATVCYPVQSVIIAKVTGK<MVYATSQQILGVVKSLWIKSSIKESL |
| Parental | PQPKEKTKLGSSAEIEAFAKTTHVLKHSVPLPAELSSEAKTKSVSTSGATQFMPDPKLMDHGQSHPEDID |
| P..KEKTKLGSSA.IE..AKTTHVLKHSVPLP.ELSSEA.TKS.STSGATQFM.DPKLMDHGQSHPEDID | |
| Retrocopy | PKSKEKTKLGSSAKIEVPAKTTHVLKHSVPLPTELSSEANTKSDSTSGATQFMRDPKLMDHGQSHPEDID |
| Parental | MYSTRS |
| .YSTRS | |
| Retrocopy | TYSTRS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .24 RPM | 7 .01 RPM |
| SRP051959_heart | 0 .18 RPM | 9 .70 RPM |
| SRP051959_kidney | 0 .02 RPM | 9 .21 RPM |
| SRP051959_liver | 0 .02 RPM | 12 .13 RPM |
| SRP051959_lung | 0 .15 RPM | 5 .50 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 3 .65 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 9 .22 RPM |
| SRP051959_spleen | 0 .00 RPM | 5 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000829 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017383 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004909 | 8 retrocopies | |
| Callithrix jacchus | ENSCJAG00000008249 | 2 retrocopies |
retro_cjac_1783 , retro_cjac_2464,
|
| Dipodomys ordii | ENSDORG00000011045 | 1 retrocopy | |
| Equus caballus | ENSECAG00000009229 | 1 retrocopy | |
| Homo sapiens | ENSG00000155008 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016329 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000008844 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015844 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011384 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004335 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001899 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002634 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020516 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022067 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012459 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010147 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000000429 | 1 retrocopy |