RetrogeneDB ID: | retro_amel_1035 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192849.1:1197667..1198118(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | APOOL | ||
| Ensembl ID: | ENSAMEG00000000829 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.03 % |
| Parental protein coverage: | 57.58 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | VITVSGLAGLVSARKGSRFKKIAYPLGLATLGATVCYPVQSVIIAKVTGKKAYTTSQQIYEAVKSLWTKM |
| V...SG....V...KGSR..K.AYPLGLAT.GATVCYPVQSVIIAKVTGKKAYTTSQQI.EAVKSL.TK. | |
| Retrocopy | VFEKSGIMDTVQSGKGSRINKMAYPLGLATVGATVCYPVQSVIIAKVTGKKAYTTSQQI*EAVKSLQTKI |
| Parental | NKKESFPKPKEK-SKLGNSAEIEIPAKTTDSLKHSVPLPTELSSETKTKSESTSGATQFMPDPKLMDYGQ |
| .K...F...K.K..KLGNSAEIEIP.KTTDSLK.SVPLP.ELSSETKTKSES.SGAT.FMPDPK.MD..Q | |
| Retrocopy | SKSH-FLNLKKK<AKLGNSAEIEIPVKTTDSLKYSVPLPIELSSETKTKSESPSGAT*FMPDPKPMDHSQ |
| Parental | SHPEDID-MYSTRS |
| SHPE.....YSTRS | |
| Retrocopy | SHPEYVE<VYSTRS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000829 | 1 retrocopy |
retro_amel_1035 ,
|
| Ailuropoda melanoleuca | ENSAMEG00000012749 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017383 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008249 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000011045 | 1 retrocopy | |
| Equus caballus | ENSECAG00000009229 | 1 retrocopy | |
| Homo sapiens | ENSG00000155008 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016329 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000008844 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015844 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011384 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004335 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001899 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002634 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020516 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022067 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012459 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000429 | 1 retrocopy |