RetrogeneDB ID: | retro_cjac_1613 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 17:68237389..68237704(-) | ||
| Located in intron of: | ENSCJAG00000012661 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000001235 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.55 % |
| Parental protein coverage: | 60. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MGGLVIRGIRNFNVENRA-EREISKMKPSPAPKHPSTNSLLQKQMGVNPEIEGEIARKDDKLLSFLKDVY |
| MG.....G.RNFN.ENRA.E.EISKMKPSPAP...ST.SLL..Q....PEI.GE.ARK..KL.S.LKD.Y | |
| Retrocopy | MGAVMTCGVRNFNLENRA>EWEISKMKPSPAPRPLSTSSLL*EQISLYPEIKGELARKGNKLPSPLKDAY |
| Parental | VDSKDPVSSVQVKAAETPQEP-EEFRLPKGQHFDMIN |
| .D.KDPVSS.QVKAAET..EP..E...PKG.H.D.IN | |
| Retrocopy | ADFKDPVSSAQVKAAETCPEP<KECTSPKGCHLDGIN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .13 RPM | 6 .99 RPM |
| SRP051959_heart | 0 .44 RPM | 10 .07 RPM |
| SRP051959_kidney | 0 .07 RPM | 10 .07 RPM |
| SRP051959_liver | 0 .11 RPM | 6 .48 RPM |
| SRP051959_lung | 0 .18 RPM | 5 .11 RPM |
| SRP051959_lymph_node | 0 .11 RPM | 5 .50 RPM |
| SRP051959_skeletal_muscle | 0 .11 RPM | 7 .75 RPM |
| SRP051959_spleen | 0 .48 RPM | 6 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003174 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005145 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001235 | 2 retrocopies |
retro_cjac_1613 , retro_cjac_1700,
|
| Cavia porcellus | ENSCPOG00000007618 | 1 retrocopy | |
| Homo sapiens | ENSG00000123545 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012070 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000015734 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018843 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028261 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013568 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002152 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000018435 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007506 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010911 | 1 retrocopy |