RetrogeneDB ID: | retro_cjac_1477 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 16:68787897..68788136(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SOD1 | ||
| Ensembl ID: | ENSCJAG00000008983 | ||
| Aliases: | None | ||
| Description: | superoxide dismutase 1, soluble [Source:HGNC Symbol;Acc:11179] |
| Percent Identity: | 68.24 % |
| Parental protein coverage: | 54.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | FHVHQFGDNTQGCTSAGPHFNPLSRKH-GGPEDEERHVGDLGNVTAGKDGVASVSIEDSVISLSGVHSII |
| F.VHQF..N.QGCTSAGPHFNPLS.KH..G..D.ER.V.DL.NVTAGKDG...VSI.DS.ISLSG..S.. | |
| Retrocopy | FYVHQFENNIQGCTSAGPHFNPLSQKH<HGLKDQERNVEDLDNVTAGKDGATDVSIKDSMISLSGGRS-- |
| Parental | GRTLVVHEKADDLGK |
| ..T.VVHEK..DLGK | |
| Retrocopy | --TMVVHEKPNDLGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .27 RPM | 41 .76 RPM |
| SRP051959_heart | 0 .12 RPM | 43 .83 RPM |
| SRP051959_kidney | 0 .11 RPM | 94 .76 RPM |
| SRP051959_liver | 0 .82 RPM | 203 .65 RPM |
| SRP051959_lung | 3 .01 RPM | 26 .19 RPM |
| SRP051959_lymph_node | 10 .91 RPM | 20 .41 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 39 .24 RPM |
| SRP051959_spleen | 2 .54 RPM | 28 .03 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4117 |
| Pan troglodytes | retro_ptro_2796 |
| Gorilla gorilla | retro_ggor_2763 |
| Pongo abelii | retro_pabe_3370 |
| Macaca mulatta | retro_mmul_2372 |