>retro_cjac_1172
CTAGAATCCAATAGCAGCCCTGGTGATCCAGTTGTTTTATTCCTTAAAGGCATTCCCATCAAAGGTATCGTGGGCAATCC
CACCACCACACAGTATGCCAACCTCACGCACAACTTCATCAGGAAGGCGCAGGGTACCATGAATAAAACTGATATCTAGA
AATGACCTTACCTTCCTTCAAATGTGCTCCACGAAGAATGAAACTATGCGTGCAGCAGATAAAAGCTGTTTCCTGATTAT
GATTCAGAATCCAAGGGAA
ORF - retro_cjac_1172 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: |
52.87 % |
| Parental protein coverage: |
89.58 % |
| Number of stop codons detected: |
0 |
| Number of frameshifts detected |
1 |
Retrocopy - Parental Gene Alignment:
| Parental | LQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVREID-PQNDLTFLRIRSKKNEIM |
| | L.S........V....GIPIK....NPTTTQYA.L.H.FI.KA..T....D...NDLTFL...S.KNE.M |
| Retrocopy | LESNSSPGDPVVLFLKGIPIKGIVGNPTTTQYANLTHNFIRKAQGTMNKTD>SRNDLTFLQMCSTKNETM |
|
| Parental | VAPDKDYFLIVIQNPTE |
| | .A.DK..FLI.IQNP.E |
| Retrocopy | RAADKSCFLIMIQNPRE |
|
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library |
Retrocopy expression |
Parental gene expression |
| SRP051959_colon |
0 .00 RPM |
7 .81 RPM |
| SRP051959_heart |
0 .02 RPM |
6 .75 RPM |
| SRP051959_kidney |
0 .00 RPM |
10 .14 RPM |
| SRP051959_liver |
0 .00 RPM |
6 .41 RPM |
| SRP051959_lung |
0 .00 RPM |
8 .85 RPM |
| SRP051959_lymph_node |
0 .00 RPM |
9 .89 RPM |
| SRP051959_skeletal_muscle |
0 .02 RPM |
4 .02 RPM |
| SRP051959_spleen |
0 .00 RPM |
8 .70 RPM |
Callithrix jacchus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_cjac_1172 retrocopy.
Callithrix jacchus was not studied using FANTOM5 data.
retro_cjac_1172 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_cjac_1172 has 0 orthologous retrocopies within eutheria group .
Parental genes homology:
Parental genes homology involve
20 parental genes, and
43 retrocopies.
| Species |
Parental gene accession |
Retrocopies number |
|
| Ailuropoda melanoleuca | ENSAMEG00000009179 | 1 retrocopy |
|
| Canis familiaris | ENSCAFG00000007547 | 6 retrocopies |
|
| Callithrix jacchus | ENSCJAG00000018199 | 10 retrocopies |
retro_cjac_1010, retro_cjac_1172 , retro_cjac_1274, retro_cjac_1539, retro_cjac_2071, retro_cjac_2902, retro_cjac_3185, retro_cjac_3215, retro_cjac_3260, retro_cjac_882,
|
| Equus caballus | ENSECAG00000008404 | 2 retrocopies |
|
| Echinops telfairi | ENSETEG00000018637 | 2 retrocopies |
|
| Felis catus | ENSFCAG00000002304 | 1 retrocopy |
|
| Homo sapiens | ENSG00000125971 | 2 retrocopies |
|
| Gorilla gorilla | ENSGGOG00000023900 | 1 retrocopy |
|
| Loxodonta africana | ENSLAFG00000029820 | 2 retrocopies |
|
| Microcebus murinus | ENSMICG00000003253 | 1 retrocopy |
|
| Myotis lucifugus | ENSMLUG00000004820 | 3 retrocopies |
|
| Macaca mulatta | ENSMMUG00000031253 | 1 retrocopy |
|
| Nomascus leucogenys | ENSNLEG00000010082 | 2 retrocopies |
|
| Oryctolagus cuniculus | ENSOCUG00000021027 | 2 retrocopies |
|
| Otolemur garnettii | ENSOGAG00000016802 | 2 retrocopies |
|
| Ochotona princeps | ENSOPRG00000004714 | 1 retrocopy |
|