RetrogeneDB ID: | retro_cfam_696 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 16:13084494..13084907(+) | ||
| Located in intron of: | ENSCAFG00000003181 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RAP1A | ||
| Ensembl ID: | ENSCAFG00000013686 | ||
| Aliases: | None | ||
| Description: | RAP1A, member of RAS oncogene family [Source:HGNC Symbol;Acc:9855] |
| Percent Identity: | 77.7 % |
| Parental protein coverage: | 72.83 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | EYKL-VVLGSGGVGKSALTVQFVQGIFV---EKYDPTIEDSYRKQVEVDCQQCMLEILDTAGTE-QFTAM |
| EYKL.VVL.SGGVGKSALTV.FVQG......EKYDPT...SY..Q.EV.CQQCML.ILDTAGT..Q.T.. | |
| Retrocopy | EYKLLVVLSSGGVGKSALTVRFVQGXXXXXXEKYDPTM*ESYTRQAEVHCQQCMLGILDTAGTD<QLTVV |
| Parental | RDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLAR |
| RDL.MKNGQGFALVYSITAQSTFNDL.D.RE.IL.V.DTEDVPM.LVGNKC.LEDERV.GKEQGQNLAR | |
| Retrocopy | RDLSMKNGQGFALVYSITAQSTFNDL*DPREHILWVRDTEDVPMTLVGNKCELEDERVAGKEQGQNLAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 42 .67 RPM |
| SRP017611_brain | 0 .00 RPM | 41 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 112 .53 RPM |
| SRP017611_liver | 0 .00 RPM | 28 .86 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000005384 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013686 | 1 retrocopy |
retro_cfam_696 ,
|
| Callithrix jacchus | ENSCJAG00000013392 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000007809 | 5 retrocopies | |
| Equus caballus | ENSECAG00000016434 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000010446 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000016893 | 2 retrocopies | |
| Homo sapiens | ENSG00000116473 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010571 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000001323 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000068798 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004018 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003999 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000001028 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001102 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000032463 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000027847 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000004521 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000010033 | 1 retrocopy |