RetrogeneDB ID: | retro_cfam_62 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | X:108285207..108285423(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCAFG00000030333 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCAFG00000023527 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.38 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MVPPVQVSPLIKVNRALRPSAGARYGAKRYSYLKPRAEEERRVAAEEKKQQEERKRIERELAEARDDSIL |
| MV..VQVSPLIK.N..........YG.KRYSYL.P.A..ERR.AAEEKK.Q.E.K.IEREL.EA.DDS.L | |
| Retrocopy | MVLLVQVSPLIKLNHDPVLFLSVAYGVKRYSYLRPQAKDERRRAAEEKKKQDEQKWIERELSEAQDDSLL |
| Parental | K |
| K | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 74 .80 RPM |
| SRP017611_brain | 0 .00 RPM | 15 .88 RPM |
| SRP017611_kidney | 0 .00 RPM | 81 .16 RPM |
| SRP017611_liver | 0 .00 RPM | 17 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy |
retro_cfam_62 ,
|
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |