RetrogeneDB ID: | retro_amel_1761 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL194231.1:117625..117811(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP5I | ||
| Ensembl ID: | ENSAMEG00000016722 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.29 % |
| Parental protein coverage: | 87.32 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MVPPVQVSPLIKLGRYSALFLGMAYGAKRYSYLKPRAEEERRIAAEEKKKQDERKRIERELA |
| M.P...VSP.I.L....ALFL..AYGA..YS..K...EE..RIAAEEKKKQDE.KRIERE.. | |
| Retrocopy | MAPLL*VSPFIRLSHGPALFLSVAYGARCYS*TKSWVEEGKRIAAEEKKKQDEQKRIEREVS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000016722 | 2 retrocopies |
retro_amel_1171, retro_amel_1761 ,
|
| Bos taurus | ENSBTAG00000017496 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000023527 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001989 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000008678 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029708 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011414 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000050856 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000012271 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000064 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002962 | 1 retrocopy |