RetrogeneDB ID: | retro_cfam_1519 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 33:6243647..6243842(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HMGN2 | ||
| Ensembl ID: | ENSCAFG00000023168 | ||
| Aliases: | HMGN2, HMG-17 | ||
| Description: | Canis lupus familiaris non-histone chromosomal protein HMG-17 (HMGN2), mRNA. [Source:RefSeq mRNA;Acc:NM_001003101] |
| Percent Identity: | 73.85 % |
| Parental protein coverage: | 72.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | EGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKDGNNPAE |
| .GDA.G.KAKV.DEPQ.RSARLS.KP.PPKPEPKPK.A..K.GEK.PKGK.G...AGKDGNNPA. | |
| Retrocopy | KGDARGGKAKVGDEPQTRSARLSPKPTPPKPEPKPKMASSKQGEKGPKGKRGTVEAGKDGNNPAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 112 .05 RPM |
| SRP017611_brain | 0 .00 RPM | 22 .87 RPM |
| SRP017611_kidney | 0 .00 RPM | 60 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 19 .14 RPM |