RetrogeneDB ID: | retro_btau_638 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 16:9705338..9705617(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PTP4A2 | ||
| Ensembl ID: | ENSBTAG00000039121 | ||
| Aliases: | PTP4A2, PTP4A3 | ||
| Description: | protein tyrosine phosphatase type IVA 3 [Source:RefSeq peptide;Acc:NP_001098468] |
| Percent Identity: | 69.47 % |
| Parental protein coverage: | 52.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | WLNLLK-TKFREEPGCCVAVHCVAGLGRA--PVLVALA----LIECGMKYEDAVQFIRQ-KRRGAFNSKQ |
| WL.LLK.TK..EE.GCCV..HCVAGLGR...PV..AL.....L.E..M..EDA.QFIRQ.KRRGAFNSKQ | |
| Retrocopy | WLSLLK<TKYPEEQGCCVVAHCVAGLGRGPVPVALALIECGMLNEVHMWNEDAFQFIRQ>KRRGAFNSKQ |
| Parental | LLYLEKYRPKMRLRFRDTNGHCCVQ |
| LLYLEKY.PKM.L.FRDTN.H.CVQ | |
| Retrocopy | LLYLEKYQPKM*LCFRDTNRHYCVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 95 .53 RPM |
| ERP005899_muscle | 0 .00 RPM | 128 .12 RPM |
| SRP017611_brain | 0 .00 RPM | 77 .88 RPM |
| SRP017611_kidney | 0 .00 RPM | 89 .09 RPM |
| SRP017611_liver | 0 .00 RPM | 83 .44 RPM |
| SRP030211_testis | 0 .01 RPM | 63 .08 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002275 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000039121 | 1 retrocopy |
retro_btau_638 ,
|
| Bos taurus | ENSBTAG00000046467 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000006539 | 2 retrocopies | |
| Homo sapiens | ENSG00000184007 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028788 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002137 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002060 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029603 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001606 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000050044 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000003605 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002775 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000006790 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016571 | 2 retrocopies |