RetrogeneDB ID: | retro_btau_578 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 15:39610127..39610338(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | LAMTOR3 | ||
| Ensembl ID: | ENSBTAG00000007923 | ||
| Aliases: | LAMTOR3, MAP2K1IP1, MAPKSP1 | ||
| Description: | Ragulator complex protein LAMTOR3 [Source:UniProtKB/Swiss-Prot;Acc:Q17QQ1] |
| Percent Identity: | 71.83 % |
| Parental protein coverage: | 56.45 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | FALATDQGSKLGLSKNK-SIICYYNTYQVVQFNRLPLVVSFIASSNANTGLIVSLEKELAPLFEELRQVV |
| FAL....G....L.K.K..IICYYNTYQVV.F..LP.VVSFIASSNANT.LIVSLEKE.APLFEELRQ.V | |
| Retrocopy | FALKKTKGENSDLQKRK>CIICYYNTYQVVEFSPLP*VVSFIASSNANTVLIVSLEKEIAPLFEELRQIV |
| Parental | E |
| . | |
| Retrocopy | D |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 60 .20 RPM |
| ERP005899_muscle | 0 .00 RPM | 25 .18 RPM |
| SRP017611_brain | 0 .00 RPM | 28 .78 RPM |
| SRP017611_kidney | 0 .00 RPM | 49 .20 RPM |
| SRP017611_liver | 0 .00 RPM | 15 .40 RPM |
| SRP030211_testis | 0 .04 RPM | 23 .29 RPM |