RetrogeneDB ID: | retro_btau_1601 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 8:29003258..29003598(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RAC1 | ||
| Ensembl ID: | ENSBTAG00000009233 | ||
| Aliases: | None | ||
| Description: | Ras-related C3 botulinum toxin substrate 1 [Source:UniProtKB/Swiss-Prot;Acc:P62998] |
| Percent Identity: | 57.26 % |
| Parental protein coverage: | 63.89 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | VFLICFSLVSPASFENVRAKW-YPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAM |
| .F.ICFSL.S.AS.ENV.A...YPE..HHC.NTPI.L.GTKLDLR.DKD...KLKE...T..TYP.G.A. | |
| Retrocopy | IFSICFSLLSSASCENVHATY<YPEM*HHCLNTPIALLGTKLDLR*DKDMTVKLKE-RMTAVTYPYGVAT |
| Parental | AKEIGAVKYLECSALTQRGLKTVFDEAIRAVL-CPPPVKKRKRKCLL |
| ..EI.A.KY.EC.AL.Q.G...VFDEA...VL..PP..K......LL | |
| Retrocopy | VEEICAMKYQECWALIQ*GSYMVFDEALTEVL<LPPRSKRMREHLLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 26 .10 RPM |
| ERP005899_muscle | 0 .00 RPM | 201 .65 RPM |
| SRP017611_brain | 0 .00 RPM | 102 .09 RPM |
| SRP017611_kidney | 0 .00 RPM | 107 .58 RPM |
| SRP017611_liver | 0 .00 RPM | 33 .98 RPM |
| SRP030211_testis | 0 .01 RPM | 42 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009233 | 2 retrocopies |
retro_btau_1601 , retro_btau_332,
|
| Canis familiaris | ENSCAFG00000015716 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026733 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021075 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000009956 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018910 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000007272 | 4 retrocopies | |
| Xenopus tropicalis | ENSXETG00000027593 | 1 retrocopy |