RetrogeneDB ID: | retro_btau_1173 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | 29:18382769..18383219(+) | ||
| Located in intron of: | ENSBTAG00000020268 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | UBE2N | ||
| Ensembl ID: | ENSBTAG00000021767 | ||
| Aliases: | None | ||
| Description: | Ubiquitin-conjugating enzyme E2 N [Source:UniProtKB/Swiss-Prot;Acc:Q0P5K3] |
| Percent Identity: | 91.39 % |
| Parental protein coverage: | 99.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR |
| MAGLP.RIIKETQRLLAEPVPG.KA.PDESNARYFHVVIA.PQDSPFEGG.FKLELFLPE.YPMAA.KV. | |
| Retrocopy | MAGLPHRIIKETQRLLAEPVPGVKAKPDESNARYFHVVIASPQDSPFEGGVFKLELFLPE-YPMAALKVH |
| Parental | FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA |
| FMTKIYHPNVDKLGRICLDILKDKWSP.LQI.TVLLSI.ALLSAP.PDDPLANDVAEQWKTNEAQA.ETA | |
| Retrocopy | FMTKIYHPNVDKLGRICLDILKDKWSPSLQICTVLLSI*ALLSAPIPDDPLANDVAEQWKTNEAQALETA |
| Parental | RAWTRLYAMNN |
| RAWTRLYAMNN | |
| Retrocopy | RAWTRLYAMNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .36 RPM | 36 .99 RPM |
| ERP005899_muscle | 0 .21 RPM | 57 .54 RPM |
| SRP017611_brain | 0 .00 RPM | 62 .08 RPM |
| SRP017611_kidney | 0 .41 RPM | 60 .63 RPM |
| SRP017611_liver | 0 .08 RPM | 23 .41 RPM |
| SRP030211_testis | 0 .19 RPM | 283 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021767 | 2 retrocopies |
retro_btau_1173 , retro_btau_1614,
|
| Canis familiaris | ENSCAFG00000006177 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002979 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000008581 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000001882 | 5 retrocopies | |
| Homo sapiens | ENSG00000177889 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000028985 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002944 | 7 retrocopies | |
| Macaca mulatta | ENSMMUG00000020634 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000009451 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000074781 | 6 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005695 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011287 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004832 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000005297 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007776 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000000908 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000008800 | 5 retrocopies |