RetrogeneDB ID: | retro_ttru_1520 | ||
Retrocopy location | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | scaffold_115226:70299..70538(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNPH1 | ||
| Ensembl ID: | ENSTTRG00000007022 | ||
| Aliases: | None | ||
| Description: | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 [Source:HGNC Symbol;Acc:21218] |
| Percent Identity: | 54.32 % |
| Parental protein coverage: | 51.97 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EEAAGGDRLIHEQDPAWLQQAEVVV-EVAQPSLGIGYELDRAVARSKPV-LCLFRPQSDRMLSDTIRGVA |
| EEA..G..LIHEQD.A.LQQA..V..EV.Q.SLG.GYELD.....S....LCL..PQ....LS....G.A | |
| Retrocopy | EEASWGASLIHEQDLA*LQQADIVMAEVTQASLGVGYELDKPLTLSREA<LCLLCPQHGQALSAMTWGTA |
| Parental | EGSQVQVWGYE |
| .GSQV.VW.Y. | |
| Retrocopy | DGSQVHVWDYK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012390 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000019913 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001837 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005337 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006660 | 1 retrocopy | |
| Felis catus | ENSFCAG00000009722 | 1 retrocopy | |
| Homo sapiens | ENSG00000112667 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000516 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016635 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029662 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000008743 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018397 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000007022 | 1 retrocopy |
retro_ttru_1520 ,
|