RetrogeneDB ID: | retro_tsyr_91 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | GeneScaffold_2520:30762..31171(+) | ||
| Located in intron of: | ENSTSYG00000011941 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C1orf43 | ||
| Ensembl ID: | ENSTSYG00000012777 | ||
| Aliases: | None | ||
| Description: | chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:29876] |
| Percent Identity: | 93.43 % |
| Parental protein coverage: | 64.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | PQLLADDDVRLLQLETQGNQNCYNYLYRMKALDAIRASEIPFHAEGRHPRSLMGKNFRSYLLDLRNTSTP |
| PQLLADDDVRLLQLETQGNQNCYNYLYRMKALDAIRASEIP.HAEGRHPRSLMGKNF.SYLLDLRNTS.P | |
| Retrocopy | PQLLADDDVRLLQLETQGNQNCYNYLYRMKALDAIRASEIPLHAEGRHPRSLMGKNFCSYLLDLRNTSIP |
| Parental | -FKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATVVKARIGSSQR-HQSAAKDLTQS |
| .FKGV.KALI.TLLDGYETARYGTGVFGQNEYL.YQEALSELAT.VKARIGSSQR.HQSAAKDLTQS | |
| Retrocopy | >FKGVHKALIYTLLDGYETARYGTGVFGQNEYLCYQEALSELATMVKARIGSSQRQHQSAAKDLTQS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000009722 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000005454 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000001056 | 15 retrocopies | |
| Macropus eugenii | ENSMEUG00000002600 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013338 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017237 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000027942 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000012008 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000007244 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000000785 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000017758 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000012915 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013866 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012777 | 1 retrocopy |
retro_tsyr_91 ,
|